PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do002598.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family Dof
Protein Properties Length: 342aa    MW: 34971 Da    PI: 8.8753
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do002598.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof120.94.7e-38111168562
      zf-Dof   5 alkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                 +l+cprCdstntkfCy+nnyslsqPr+fCkaCrryWt+GGalrnvPvGgg+r+n k+s
  Do002598.1 111 TLRCPRCDSTNTKFCYFNNYSLSQPRHFCKACRRYWTRGGALRNVPVGGGCRRNTKRS 168
                 579***************************************************9886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-3193166IPR003851Zinc finger, Dof-type
PfamPF027011.3E-31112166IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.385112166IPR003851Zinc finger, Dof-type
PROSITE patternPS013610114150IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    Send to blast
MVFSSLPIFL DPPNWGQMQM QQQQQQQQQP LQCLLGGGGG VGSDHHHLMP PPSGLAPLPG  60
GPADTAASAP AGGGSSTSMQ AAGAGAAQPR PVVSMAERAR LARVPLPDPG TLRCPRCDST  120
NTKFCYFNNY SLSQPRHFCK ACRRYWTRGG ALRNVPVGGG CRRNTKRSSK KSSRSGQGGG  180
AGATAATSSS STTSTSTTAT TTTTTSAAMA AAEAIASMQA QLPHLGLPPA AAAAALEASL  240
EGYHHYLPFQ MQPQFLQQAG LHGYHFADDG SGVLADGFPR GVVASGLLAQ LAAVKMEEHS  300
SGGGGGMAAH EQSYWPGSTG GGSGWPGEFL SGFSSSSSGN VL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC5824190.0KC582419.1 Sorghum bicolor dof28 protein (dof28) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008668091.11e-158PREDICTED: uncharacterized protein LOC100273972 isoform X1
SwissprotQ9M2U11e-44DOF36_ARATH; Dof zinc finger protein DOF3.6
TrEMBLB6U2U91e-164B6U2U9_MAIZE; Putative uncharacterized protein
STRINGGRMZM2G176063_P011e-156(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02460.18e-39Dof family protein